She recommended bromine because our pool was unusual, being an indoor pool and not being exposed to the sun's UV rays.As many customers do, I initially decided to go with what was familiar. We shocked with borate, sanitized with the bromine and oxidizer. This website uses cookies so that we can provide you with the best user experience possible. document.getElementById("copyright_year").innerHTML = new Date().getFullYear(); The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper, Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinityfilter sand ground above sandman wave system inch pump pools pool swimming filters gallon 1hp hp Very nice people, there helped me with everything I needed. We can have a nice peaceful swim or turn on the whitewater rapids for my grandkids, come summer or winter.Thank you Pam, Donnie, Nick, Ryan, and Jeremy! "But, with our water being unchlorinated and not exposed to the sun operating the pool, testing, balancing, and cleaning were unusually complicated. - Sending you the newsletter, which at all times shall be customized and adapted to your interests. Target does not represent or warrant that this information is accurate or complete. We are getting a little older and hope this swim spa will add a few more years onto our once sedentary lifestyle. 3 models available and 2 sizes each (16m3 and 20m3 ): concrete, prefabricated and panel pools. We knew exactly what was happening and they always answered any of our questions. They showed up when they said they'd be there (a rare occurrence in Lexington), and did excellent work. It's a white powdery substance made from the crushed fossils of aquatic organisms called diatoms, often referred to as "water polishers" because they leave pool water sparkling clean. Considering a single strand of human hair measures just 50 microns and bacteria can be as small as 2 microns, having a pool filter that can filter out the smallest contaminants from your pool water is essential to its clarity. Prices, promotions, styles and availability may vary by store & online. DE pool filter tanks contain several grids coated with diatomaceous earth. ZODIAC is a registered trademark of Zodiac International, S.A.S.U., used under license. document.getElementById( "ak_js_1" ).setAttribute( "value", ( new Date() ).getTime() ); 4470 Washington Rd., Evans, GA 30809Phone: 706-863-1207, Lexington / Columbia5541 Sunset Blvd., Lexington, SC 29072Phone: 803-373-2238. We just had our pool liner replaced and Don and his crew did a great job! Pete and Toni are amazing people with a matching work ethic. As I was not the original purchaser they were unwilling to help. Two-in-one skimmer and filter solution :
Thank you Steph & Pete, Super helpful staff! And all the crew at Pete Alewine's Pool and Spa! It was amazing! I just wanted to give a shout out to Pete Alewine's Pool and Spa (PAP&S) with particular attention to their crew. However, DE filters are more expensive and require the most maintenance of the three pool filter options. Easy to install to your skimmer wall cut out, all sized for standard hayward hole opennings. There were big balance swings, excessive solids (remember that well water), and ever rising chlorine stabilizer!I had to drain the pool and restart. Copyright 2022 Swimming Pool Discounters. See our price match guarantee. This field is for validation purposes and should be left unchanged. Water is introduced through the filter, runs through the material, and sends clear water back into the pool. We are now enjoying our pool year round! Super nice and are ALWAYS helpful to me!! Further cleaning of the grids may be necessary each year to help your pool filter operate more efficiently and last longer. 2017 Expertos en Piscinas y Spas AstralPool. I am so glad I chose Pete Alwine. These replacement filter cartridges filter out debris, dirt, and other contaminants thanks to ultra-fine, heavy-duty paper with more pleats than your average pool filter cartridge. Great Customer service and a very knowledgeable team over at Pete Alewine Pool & Spa. If you need someone to reprogram your pool automation, ask them to send Nick. Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinity 1 Quart Liquid Magnet 1 Quart Black Algae Out 1 Quart Jump Start 1 Quart Krystal Klear 24 Lbs Jumbo 3" Slow Tab 24 Lbs Green Out Shock Jumbo 3" Slow Tab Chlorine Slow Dissolving Jumbo Tabs Manufactured to resist crumbling. Keeping this cookie enabled helps us to improve our website. The answer to that question comes down to what is important to you. Incorporate gate, regulator lid height, skimmer basket and 2 cartridge filters. A cartridge filter uses cloth-type material as the filtering agent. 2-in-1 Backwash Valve with NeverLube Technology. Join us on our Social Media channels: like us onFacebook, follow us onGoogle+,Instagram,PinterestandTwitter, or visit us onYouTube. I love our pool and the process was seamless! Every filter does the same thing. A regular hose would take forever, possibly days. Great guys!! This pool was installed by Petes team in 2012 and we have always used the services from his locations. They are staffed with hard working professionals who are also friendly and go out of their way to see that all things are running smoothly. Pre Filter your water before it reaches the pump and filter system. I was accustomed to outdoor pools and it was like going back to chemistry class!Pam Wilmot, was our salesperson. This is the pool cycle. Nick was able to troubleshoot the exact nature of the problem in less than 30 minutes. But I believe her true forte is her knowledge of pool operation. Any help needed with questions answered ask for Kelvin. We have a great staff that really cares about our customers and community. Apple is not a participant or sponsor of this promotion.
This website claims no credit for any images posted on this site unless otherwise noted. Your pool's filter has an important job - to keep your pool clean. Apple and the Apple logo are trademarks of Apple Inc., registered in the U.S. and other countries. You are hereby informed that you may exercise your right to submit complaints to the competent supervisory authority, namely, in the case of Spain, the Spanish Data Protection Agency at www.agpd.es. A sand filter holds 250 lbs or more of special filter sand. Pete had great ideas for the layout, and Stephanie was very helpful with design.
Also a Great Job to (Forgot his name, sorry!!) Advantages: Low upfront cost, easy maintenance, sand lasts 5 to 7 years before needing to be changed, filtration efficiency can be boosted with additives or alternative media Disadvantages: 20-micron filtration is the least effective of the three types and backwashing is viewed by some as not environmentally friendly due to water waste. People working there are smart and quite friendly. All sand filters have an installed pressure gauge. progrid hayward This means that every time you visit this website you will need to enable or disable cookies again. This is accomplished easily by backwashing the filter. Thanks!! Pete Alewine sells and services two types of pool filters: sand filters and cartridge filters. Once the water is clean, it is sucked by the pump and sent back to the pool. And we didn't want to just run an industrial fire hose through the window into the pool.Ryan was the initial spa technician who came out and discussed our install. Aqua-line inline cartridge filters provide your pool with crystal clear water and can accommodate all size pool depending on unit. This field is for validation purposes and should be left unchanged. My wife can just step into the pool which comes up 19.5" above the floor.This provided considerable maintenance access below deck. This customization is partially automated, in that FLUIDRA calculates the customization settings, but the technological platform generates the user profile. We needed to have city water delivered via tanker. All Rights Reserved. Without them, you may have problems in the correct visualization of the page. A pressure gauge on the sand filter alerts you when internal pressure increases and it's time to backwash the filter. They also will load pool salt in your vehicle for you :)They also replaced my pool liner and did a really good job. Products shown as available are normally stocked but inventory levels cannot be guaranteed, For screen reader problems with this website, please call 1-800-430-3376 or text 38698 (standard carrier rates apply to texts), It's easy to overlook, but even your vacuum needs a good cleaning now and then, Happy Tab - Holds TWO 3 in. Very helpful staff with great quality pool products. 2141 Babcock Blvd Pittsburgh, PA 15209 Ph: 1-888-GET-POOL. If the item details above arent accurate or complete, we want to know about it. Advantages: Filters contaminants as small as 10 microns, no backwashing; less water waste, performs well at low speeds, such as with variable-speed pool pumps, cartridge inserts are inexpensive to replace, mid-cost filter Disadvantages: Requires slightly more manual work than sand pool filters, cartridge needs to be replaced every 2 to 3 years, deep cleaning required 1 to 2 times per year. Pete Alwine, hang on to this guy, Nobody in this area has someone with his talent! But we still didn't have enough well water to fill our pool. Francesc Maci, 60, planta 20, 08208, Sabadell (Barcelona) and holder of TIN A-17728593.Your data shall be processed for the sole purpose of sending you information about the product selected.Furthermore, provided you have given us your consent to do so by ticking the respective boxes provided for this purpose in your contact details, we may process your data for: 2022 Zodiac Pool Systems LLC - All rights reserved. The media that it uses to do that job (sand, cartridges, etc. I highly recommend. when your cartridge gets dirty, just remove it from the filter unit, spray some filter cleaner on the cartridge, let it sit for 10 or 15 min and then wash it off with clean water and reinsert the cartridge into your filter unit. The whole team was great to work with and every time there was an issue that came up they had it resolved in no time ! After less than an hour Nick got my hot tub working again, (and got me out of the virtual dog house with the family). They got it done earlier than expected and the best thing about it was it was 100% stress free for me! Less chemicals, less fussing, and less cost!! Units will give you years of trouble free cleaning. The color change is proposed with an inlet sheath EASYCOLOR- both the embellisher and the floater. Pool filters are classified by the size of contaminants they can collect. I would really recommend trying Pete Alewine Pool & Spa and see for yourself, honest people. Our main number is (706) 863-1207. I am very pleased with the hot tub and I highly recommend Pete Alewine Pools for both their expertise and their first-rate customer service. Make sure you keep your pool safe and sparkling clean all season long with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge. skimmer gph canister summerbackyard Need Help? A safer alternative for all D.E B4U Filter Pre-Filter Skimmer System for Above Ground Swimming Pools, Includes: Extra-Deep Sifter Basket 2X Deeper. The innovative skimmer filtration system combines the functions of a skimmer and filter pump in one unit. Instead of adding the DE powder to the grids, you'll get better results by adding it through your pool's skimmer. Pursuant to the regulations in force on personal data protection, you are hereby informed that your personal data shall be processed by FLUIDRA S.A. (hereinafter FLUIDRA), located at Avda. They built our pool and spa! Country*COUNTRY*AUSTRALIAAUSTRIABELGIUMBRAZILBULGARIACANADACHILECHINACOLOMBIACROATIACYPRUSCZECH REPUBLICDENMARKEGYPTFRANCEGERMANYGREECEHONG KONGHUNGARYINDIAINDONESIAITALYKAZAHSTANMALAYSIAMEXICOMONTENEGROMOROCCONETHERLANDSNEW ZEALANDPOLANDPORTUGALROMANIARUSSIASERBIASINGAPORESOUTH AFRICASPAINSWEEDENSWITZERLANDTHAILANDTUNISIATURKEYUAEUNITED KINGDOMUSAVIETNAMOTHER COUNTRIES, Subject *Extra product informationComplete catalog. Standard sand used in sand pool filters are capable of filtering contaminants that measure 20 microns and larger. Diatomaceous earth is a natural, eco-friendly water polisher. If you have a specific question about this item, you may consult the item's label, contact the manufacturer directly or call Target Guest Services at 1-800-591-3869. All Aqua-line filters come with a new filter cartridge. I called and talked to John. We had an old tired pool and spa, waterline tiles cracked and in disrepair, concrete cracked and in disrepair and plaster cracked and in disrepair. I never experienced this kind of high quality work before. ), is really the only difference. Reduces the amount of dirt going into your filter system and dramatically increases the length of the filter cycle. Superior outfit to work with. The design of the CL Cartridge Filter takes advantage of the filters total surface area, providing the clearest water possible and extended cleaning cycles. All complete with pipe connectors, stainless steel clamps and all connection hoses. The first steps in deciding what pool filter is best for your pool is knowing what types of filters there are and how they work. When I started looking for a Hot Tub, I returned to them. Be aware, some locations may have regulations that specify how to legally dispose of used DE.
This sheath could be installed without change the skimmer mouth what is very practical to renew or upgrade pools. In this case, you would remove the grids from the filter tank and hose off excess dirt before soaking them in a filter cleaning solution to remove body oils, suntan lotions, organic materials and minerals. The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper SYSTEM INCLUDES: Complete Skimmer Standard Basket Vacuum Adapter Complete Return Fitting Hardware Gaskets Easy AquaPerl Direct Replacement for Diatomaceous Earth D.E AquaPerl Perlite Filter Powder is a new, lightweight, direct replacement for diatomaceous earth media. In certain cases, access shall be given to them to any of FLUIDRA's service providers that render certain services to FLUIDRA (such as sending the newsletter), but under no circumstances shall they process them for their own ends.We shall keep your personal data for the maximum statutory term and for as long as FLUIDRA is obliged to do so, notwithstanding the fact that your data may be kept for the statutory term that may apply at any given time so that FLUIDRA is able to comply with the regulations in force.The processing of your data is legitimate because you have given your consent to do so.You may exercise your rights to access, rectification, erasure, restriction of processing, data portability and to object, or to withdraw the consent given in for sending you messages or for processing your personal data, by sending a letter to the data controller at Avda.
I made the mistake of buying a spa at the Civic Center during a sale. I hired them to upgrade my pool pump, switch to a salt water system, new filter, etc. for doing a great Job measuring the liner!! Maintenance is my #1 priority on the next spa I buy and Pete Alewine proved they have the very best service in the CSRA. Knowing when to backwash a sand filter is easy. The skimmer drains the water and retains any debris. Very pleased with our experience with them. We had water delivered, and this time, I listened to Pam. First and foremost, what is diatomaceous earth? Nautical Reef Above Ground Swimming Pool Liner, Black Diamond 525 Quad Cartridge Filter Tank For In Ground Swimming Pools, The Colossus Complete Skimmer System for Above Ground Swimming Pools, Opening Pool Chemical Kit for Above and In Ground Swimming Pools, Opening Pool Chemical Kit for In Ground Swimming Pools, 8lb Jumbo 3" Slow Tab Swimming Pool Chlorine Trichloro, Green Out Premium Pool Shock 1 lb Bags Fast Acting Formula, Hayward EC40 DE Filter with Blue Torrent 1 Pump, HydroMax 85 Auto-Regen DE Filter System - Tank Only, Perlite Diatomaceous Earth Alternative for DE Pool Filter Systems. They maintained my pool for years, not once have I ever received bad service from this business, The consummate professionals. Thank to Ben at the Evans location for getting us setup as well! Using genuine Jandy factory replacement parts helps to ensure the ongoing quality and reliability of our products. This pump skimmer set has everything you need for installation, including hoses and hose clamps. SEO. A budget-friendly option that requires minimal maintenance, sand filters are ideal for in-ground or above-ground pools. Just remove your old skimmer and replace with this unique water filtration system! The Jandy Pro Series Backwash Valve features a straight-through, full-flow port design that optimizes flow and hydraulic efficiency. As water continuously flows through the filter, the contaminants trapped between the sand begin to build up eventually restricting the flow of water, increasing internal pressure and reducing the filter's efficiency. This unit fits a standard skimmer cut out on your swimming pool. When the internal pressure of the filter rises 10 psi from when it was last cleaned, the owner knows that it is time to clean out the residue inside the sand. This filter pump attaches to the sidewalls of your framed pool and features easy maintenance and prevents tripping over hoses and pumps that would normally be on the ground. I must say our installation was anything but ordinary and still they handled it with enthusiasm and professionalism!They delivered the pool in a very restricted space with overhead power lines and managed to lower it through a gap in the new roof construction with a crane. I am well out of their service area, but I can't express enough how grateful I am that they took the time to make sure I got my spa repaired. My pool was green when it was opened this year, and when I went to the store I was approached right away by a very helpful employee who went above and beyond talking me through what to do! Its job is to catch debris, so as to limit the particles floating out in the pool. The diatoms act just like a sponge water can pass through, but microscopic impurities like dirt, algae, and some forms of bacteria can't. All rights reserved. We highly recommend Pete Alewine and his staff for all your pool and spa needs! pool canopy ground above shade pools frame metal fits round summer accessories brandsonsale parts escapes oval summerbackyard 2020 Pete Alewine Pool & Spa. We recommend that you do not rely solely on the information presented. Every cartridge only needs to be replaced every 2 weeks, giving you the time to enjoy a refreshing summer all season long. JS Series Sand Filters are versatile and efficient. 1. Some of the cookies are necessary to navigate the site. Economical Alternative to Provide Basic Backwash Functions. Made of ABS with UV treatment. Very friendly and understanding staff that has earned my loyalty. Designed for long-lasting and problem-free pool filtration that rids your pool of impurities, so you can swim, soak and splash around. Appreciate that they have found cheaper alternative solutions when I came in asking for more expensive ones and have saved me $100s by giving me free advice to try before buying new products from them. Find out more about our Service Department today by clicking here. He installed the LARGE filters, balanced and sterilized the water, and walked us through the controls from pumps to the LED lights and Wifi sound system. Unique skimming technology continuously removes debris from the water surface, while the filter cartridge and the ultra-fine filter paper purifies the pool water. This filtration system is specifically designed for Summer Wave framed pools. I was in and out very quickly.
After every cleaning, you'll need to add more DE powder.
- Continuous Run Unloader Valve
- Cheap Hotels In Gresham, Oregon
- Continental Terraincontact A/t 265/50r20
- Long Sleeve Flowy Dress Near Me
- Topshop Editor Jeans Petite
- Scenic Train Rides In Kansas
- Ultraspire Bronco Race Vest
- Oreck Orbiter All-in-one Floor Cleaner
- Large Magnetic Sheets
- Fluted Wood Dining Table
- Cotton Linen Throw Blanket
- Do Anglicans Wear Crucifixes
